PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01188A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family EIL
Protein Properties Length: 484aa    MW: 53410.3 Da    PI: 4.4544
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01188AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3183.91.5e-56801981112
                                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX........XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa.......tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgii 77 
                                eel++rmw+d+m+lkrl+e ++ + +d+ +         g++k ++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgii
  Oropetium_20150105_01188A  80 EELERRMWRDRMKLKRLRELQQTRGKDQASGggsggggDGSSKPRQSQEQARRKKMSRAQDGILKYMLKMMEVCRAQGFVYGII 163
                                8********************999988887799999888899999*************************************** PP

                                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                       EIN3  78 pekgkpvegasdsLraWWkekvefdrngpaaisky 112
                                pekgkpv+gasd+LraWWkekv+fdrngpaai++ 
  Oropetium_20150105_01188A 164 PEKGKPVSGASDNLRAWWKEKVRFDRNGPAAIANA 198
                                *********************************97 PP

2EIN329.41.4e-09205309279354
                                XXXXXXX.XXXXXX.XXXXXXXXXX............................XXXXXXXXXXXXXXXXXXXXX......XXXX CS
                       EIN3 279 eqkedve.gkkeskikhvqavktta............................gfpvvrkrkkkpsesakvsskevsrtcqssq 333
                                ++++dv+  ++ +   ++ ++k++                             ++++++kr+++ s +   + ++ ++tc++ q
  Oropetium_20150105_01188A 205 SSEYDVDlAEDCKGGDEAGNQKAAVsdptafnlgaailsdkflmpapmkeetaDIEFIQKRNAPASAEPELMLNNRVYTCNNGQ 288
                                55777775333333333333333335566678888888888888888888888*********987765555555567******* PP

                                XXX.XXXXXXXXXXXXXXXXX CS
                       EIN3 334 frgsetelifadknsisqney 354
                                ++++++  +f d+n++++++y
  Oropetium_20150105_01188A 289 CPHNDYGYGFLDRNARNSHQY 309
                                *******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.1E-5380199No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MMGGLMMDQS MVFPGVHNFV DLLQQNGAGG DKNLGFGPLM TQTSSGDQCV MGEGDLVDPP  60
PDSFPDAGED DSDDDMEDIE ELERRMWRDR MKLKRLRELQ QTRGKDQASG GGSGGGGDGS  120
SKPRQSQEQA RRKKMSRAQD GILKYMLKMM EVCRAQGFVY GIIPEKGKPV SGASDNLRAW  180
WKEKVRFDRN GPAAIANAIS FNASSSEYDV DLAEDCKGGD EAGNQKAAVS DPTAFNLGAA  240
ILSDKFLMPA PMKEETADIE FIQKRNAPAS AEPELMLNNR VYTCNNGQCP HNDYGYGFLD  300
RNARNSHQYT CKYNDPLPQS AENKPTPPPP QAFPATFNQP NQALNNLDFG LPMDGQRSIA  360
ELMNMYDNNF MNKNMGSDSV TIMERPAALP QRIQMDDGFF GQGNGVFDDV SNMMQQPPQQ  420
APVEQQHQQQ QFFIRDDSQF GNQMGDINGA SEFRFGSSFN MPGAVEYPGA TAQQKNEGTN  480
WYY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984528.11e-151PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246064e-54EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLM0UV890.0M0UV89_HORVD; Uncharacterized protein
STRINGSi034616m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-44ETHYLENE-INSENSITIVE3-like 1